PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN540293.1_FGP005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 1045aa    MW: 114210 Da    PI: 4.6128
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN540293.1_FGP005genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-1756103148
                        TSSS-HH.HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTte.EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT+e Ed+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  KN540293.1_FGP005  56 KGNWTPEeEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 103
                        799**8725789*********************.*************97 PP

2Myb_DNA-binding47.15.4e-15109151145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  KN540293.1_FGP005 109 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 151
                        579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.99451107IPR017930Myb domain
SuperFamilySSF466898.99E-2854150IPR009057Homeodomain-like
SMARTSM007173.6E-1455105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2457111IPR009057Homeodomain-like
CDDcd001671.07E-1358103No hitNo description
PfamPF139212.7E-1559120No hitNo description
PROSITE profilePS5129419.654108158IPR017930Myb domain
SMARTSM007174.4E-14108156IPR001005SANT/Myb domain
CDDcd001677.58E-11111151No hitNo description
Gene3DG3DSA:1.10.10.607.0E-21112158IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1045 aa     Download sequence    Send to blast
MAIGVMMTSD NGKAPEKGGE ASGPSSAPQE GEISNEPQRR RPLSGRTTGP TRRSTKGNWT  60
PEEEDDIIVQ MVNKLGPKKW STIAQALPGR IGKQCRERWH NHLNPGINKE AWTQEEEITL  120
IHAHRMYGNK WAELTKFLPG RTDNAIKNHW NSSVKKKVDS YMSSGLLTQV SCLPLNEYSA  180
HCNSSPAVTQ QNSEDSGSYA VREVENSSVC SQSSLAKVSC SQVHNANVAL GCDLQVNANV  240
DNNEAHDSQS SVGHEACYTS VGAVATAMPE VHYHVSSSNF DPDQHLQEEF AQGLNLHMSI  300
DEVPSNSSFA DNPTICRIEN HERSLEPYDV AMEMPLSMLP SDSGAEQKLH FMSEADFNSP  360
NCLKSELWQD ISLQGLLSGP DAVETDSFSR SNHQSDVYSS QADNEFLAPP YLLQTSNSSS  420
VMEATYGQSP QMSVPPSLFC SNVMTDVPSD NRSEPKEMTV SQAEMVTQSS SSSGDAEMSA  480
NPGSSNGSDI PSMMERIPEC ADQQVTNAEE PEASIEKEPS VTPSATADEK QDEGALFYEP  540
PRFPSMDVPF VSCDLVTSGD LQEYSPLGIR QLMRSTMNVC TPMRLWGSPT HDESPDILLK  600
SAAKSFICTP SILKKRHRDL VSPIPDKRIE KKSGTEKDCG VSDTSSIGIQ TCFINATKDD  660
AVINKSVLRI ERSASSKPLE KKLEFSDENK ENLDNTIEQA KDGQSAGNDK HIDEQARGER  720
RTATNITTTY DDLPGNLQPA GILIEHNGDD LVSPDYGKNT MKQKQNTNME SLSVCKEGVS  780
AKKPVELIVD KSSACINVDY EYVNILADTP GIKRGLESPS AWKSPWFVDM QFQGSYFVSP  840
ANGYDALGLV KQINVQTAAA LAEAREVLAS GVQSENINSD KENLENPDAK KEPGATTKLQ  900
AKNKVFHQLE KLKLELETRK KEGRARAYFG RSHSAPPPLP ASPAYFSPLS DYSGLRRSAP  960
STTDPPFAGL LSSPPNASLV VTSGWTSSFS LEIDFEGNGD ESHLTDGDNG GEEHKRHEAP  1020
DAPSFSLGID SDNDDDEECR REEQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C8e-43561584105C-Myb DNA-Binding Domain
1mse_C8e-43561584105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4300510.0AJ430051.1 Oryza sativa mRNA for transcription factor myb (myb3R1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625869.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLA0A0E0FAR20.0A0A0E0FAR2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036408-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.22e-61myb domain protein 3r-4